Recombinant Human ERP29 Protein (40-251 aa), GST-tagged

• Cat.No.: ERP29-1215H
• Product Overview: Recombinant Human ERP29 Protein (40-251 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 40-251 aa
• Description: Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 51.0 kDa
• AA Sequence: PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ]
• Official Symbol: ERP29
• Synonyms: ERP29; ERp28; ERp29; ERp31; PDI DB; PDIA9; PDI-DB; C12orf8
• Gene ID: 10961
• mRNA Refseq: NM_001034025
• Protein Refseq: NP_001029197
• MIM: 602287
• UniProt ID: P30040