Recombinant Human ERP29 Protein (40-251 aa), GST-tagged
Cat.No. : | ERP29-1215H |
Product Overview : | Recombinant Human ERP29 Protein (40-251 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 40-251 aa |
Description : | Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 51.0 kDa |
AA Sequence : | PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ] |
Official Symbol | ERP29 |
Synonyms | ERP29; ERp28; ERp29; ERp31; PDI DB; PDIA9; PDI-DB; C12orf8; |
Gene ID | 10961 |
mRNA Refseq | NM_001034025 |
Protein Refseq | NP_001029197 |
MIM | 602287 |
UniProt ID | P30040 |
◆ Recombinant Proteins | ||
ERP29-4606HF | Recombinant Full Length Human ERP29 Protein, GST-tagged | +Inquiry |
ERP29-1215H | Recombinant Human ERP29 Protein (40-251 aa), GST-tagged | +Inquiry |
ERP29-5314M | Recombinant Mouse ERP29 Protein | +Inquiry |
ERP29-1801R | Recombinant Rat ERP29 Protein, His (Fc)-Avi-tagged | +Inquiry |
ERP29-701H | Recombinant Human ERP29 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERP29-6544HCL | Recombinant Human ERP29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ERP29 Products
Required fields are marked with *
My Review for All ERP29 Products
Required fields are marked with *
0
Inquiry Basket