Recombinant Human ERP29 Protein (40-251 aa), GST-tagged

Cat.No. : ERP29-1215H
Product Overview : Recombinant Human ERP29 Protein (40-251 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 40-251 aa
Description : Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.
Form : Tris-based buffer,50% glycerol
Molecular Mass : 51.0 kDa
AA Sequence : PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.
Gene Name ERP29 endoplasmic reticulum protein 29 [ Homo sapiens ]
Official Symbol ERP29
Synonyms ERP29; ERp28; ERp29; ERp31; PDI DB; PDIA9; PDI-DB; C12orf8;
Gene ID 10961
mRNA Refseq NM_001034025
Protein Refseq NP_001029197
MIM 602287
UniProt ID P30040

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ERP29 Products

Required fields are marked with *

My Review for All ERP29 Products

Required fields are marked with *

0
cart-icon