Recombinant Human ESR1 protein, His-tagged
| Cat.No. : | ESR1-6854H |
| Product Overview : | Recombinant Human ESR1 protein(250-352 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 250-352 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADR |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ESR1 estrogen receptor 1 [ Homo sapiens ] |
| Official Symbol | ESR1 |
| Synonyms | ESR1; estrogen receptor 1; ESR; estrogen receptor; Era; NR3A1; ER-alpha; estradiol receptor; estrogen nuclear receptor alpha; estrogen receptor alpha delta 4 +49 isoform; nuclear receptor subfamily 3 group A member 1; estrogen receptor alpha 3*,4,5,6,7*/822 isoform; estrogen receptor alpha delta 4*,5,6,7*/654 isoform; estrogen receptor alpha delta 4*,5,6,7,8*/901 isoform; estrogen receptor alpha delta 3*,4,5,6,7*/819-2 isoform; estrogen receptor alpha delta 3*,4,5,6,7*,8*/941 isoform; ER; ESRA; DKFZp686N23123; |
| Gene ID | 2099 |
| mRNA Refseq | NM_000125 |
| Protein Refseq | NP_000116 |
| UniProt ID | P03372 |
| ◆ Recombinant Proteins | ||
| ESR1-102H | Recombinant Human Estrogen alpha receptor LBD/Hsp90 complex, GST-tagged | +Inquiry |
| ESR1-2416H | Recombinant Human ESR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ESR1-4217H | Recombinant Human ESR1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ESR1-2151R | Recombinant Rat ESR1 Protein | +Inquiry |
| ESR1-01H | Recombinant Human Estrogen Receptor 1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ESR1-6540HCL | Recombinant Human ESR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ESR1 Products
Required fields are marked with *
My Review for All ESR1 Products
Required fields are marked with *
