Recombinant Human EXOSC10 protein, His-tagged

Cat.No. : EXOSC10-3475H
Product Overview : Recombinant Human EXOSC10 protein(586-885 aa), fused to His tag, was expressed in E. coli.
Availability June 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 586-885 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name EXOSC10 exosome component 10 [ Homo sapiens ]
Official Symbol EXOSC10
Synonyms EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100;
Gene ID 5394
mRNA Refseq NM_001001998
Protein Refseq NP_001001998
MIM 605960
UniProt ID Q01780

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EXOSC10 Products

Required fields are marked with *

My Review for All EXOSC10 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon