Recombinant Human EXOSC10 protein, His-tagged
Cat.No. : | EXOSC10-3475H |
Product Overview : | Recombinant Human EXOSC10 protein(586-885 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 586-885 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | VAAGVKKSGPLPSAERLENVLFGPHDCSHAPPDGYPIIPTSGSVPVQKQASLFPDEKEDNLLGTTCLIATAVITLFNEPSAEDSKKGPLTVAQKKAQNIMESFENPFRMFLPSLGHRAPVSQAAKFDPSTKIYEISNRWKLAQVQVQKDSKEAVKKKAAEQTAAREQAKEACKAAAEQAISVRQQVVLENAAKKRERATSDPRTTEQKQEKKRLKISKKPKDPEPPEKEFTPYDYSQSDFKAFAGNSKSKVSSQFDPNKQTPSGKKCIAAKKIKQSVGNKSMSFPTGKSDRGFRYNWPQR |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | EXOSC10 exosome component 10 [ Homo sapiens ] |
Official Symbol | EXOSC10 |
Synonyms | EXOSC10; exosome component 10; PMSCL2, polymyositis/scleroderma autoantigen 2, 100kDa; p2; p3; p4; PM Scl; PM/Scl 100; polymyositis/scleroderma autoantigen 2 (100kD); RRP6; Rrp6p; autoantigen PM-SCL; autoantigen PM/Scl 2; polymyositis/scleroderma autoantigen 100 kDa; polymyositis/scleroderma autoantigen 2, 100kDa; P100 polymyositis-scleroderma overlap syndrome-associated autoantigen; PMSCL; PM-Scl; PMSCL2; PM/Scl-100; |
Gene ID | 5394 |
mRNA Refseq | NM_001001998 |
Protein Refseq | NP_001001998 |
MIM | 605960 |
UniProt ID | Q01780 |
◆ Recombinant Proteins | ||
EXOSC10-1995C | Recombinant Chicken EXOSC10 | +Inquiry |
EXOSC10-2815H | Recombinant Human EXOSC10 protein(691-850 aa), C-His-tagged | +Inquiry |
EXOSC10-5381M | Recombinant Mouse EXOSC10 Protein | +Inquiry |
EXOSC10-2902M | Recombinant Mouse EXOSC10 Protein, His (Fc)-Avi-tagged | +Inquiry |
EXOSC10-12594H | Recombinant Human EXOSC10, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOSC10-6504HCL | Recombinant Human EXOSC10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EXOSC10 Products
Required fields are marked with *
My Review for All EXOSC10 Products
Required fields are marked with *