Recombinant Human EZR Protein (1-251 aa), His-tagged
Cat.No. : | EZR-1393H |
Product Overview : | Recombinant Human EZR Protein (1-251 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-251 aa |
Description : | Probably involved in connections of major cytoskeletal structures to the plasma mbrane. In epithelial cells, required for the formation of microvilli and mbrane ruffles on the apical pole. Along with PLEKHG6, required for normal macropinocytosis. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 31.4 kDa |
AA Sequence : | MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGFPWSEIRNISFN |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | EZR ezrin [ Homo sapiens ] |
Official Symbol | EZR |
Synonyms | EZR; ezrin; p81; villin-2; CVL; CVIL; VIL2; MGC1584; FLJ26216; DKFZp762H157; |
Gene ID | 7430 |
mRNA Refseq | NM_001111077 |
Protein Refseq | NP_001104547 |
MIM | 123900 |
UniProt ID | P15311 |
◆ Recombinant Proteins | ||
EZR-3599H | Recombinant Human EZR Protein, GST-tagged | +Inquiry |
EZR-1830R | Recombinant Rat EZR Protein, His (Fc)-Avi-tagged | +Inquiry |
Ezr-2898M | Recombinant Mouse Ezr Protein, Myc/DDK-tagged | +Inquiry |
EZR-2913M | Recombinant Mouse EZR Protein, His (Fc)-Avi-tagged | +Inquiry |
EZR-8556H | Recombinant Human EZR protein(Pro2-Leu586), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZR-6486HCL | Recombinant Human EZR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZR Products
Required fields are marked with *
My Review for All EZR Products
Required fields are marked with *