Recombinant Zebrafish EZR Protein (C-ERMAD domain), His tagged

Cat.No. : EZR-17H
Product Overview : Recombinant Zebrafish EZR Protein (C-ERMAD domain) with His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Zebrafish
Source : E.coli
Tag : His
Description : The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene.
Molecular Mass : The protein has a calculated MW of 14 kDa.
AA Sequence : MHHHHHHHHHHMTAPPLPPPPPAYDHDENDLDDGEESNGSYTADLQTGGFNDHRLEEERITEAEKNERVQKQLLALTSELAQARDDTKKTQNDLLHTENVRAGRDKYKTLRQIRQGNTKQRI
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.11 mg/mL by BCA
Storage Buffer : Sterile 20 mM Tris, pH 8.0, 300 mM NaCl, 10% Glycerol
Gene Name EZR ezrin [ Homo sapiens (human) ]
Official Symbol EZR
Synonyms EZR; ezrin; CVL; CVIL; VIL2; HEL-S-105; ezrin; cytovillin 2; epididymis secretory protein Li 105; p81; villin 2 (ezrin)
Gene ID 7430
mRNA Refseq NM_003379
Protein Refseq NP_003370
MIM 123900
UniProt ID P15311

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EZR Products

Required fields are marked with *

My Review for All EZR Products

Required fields are marked with *

0
cart-icon