Recombinant Zebrafish EZR Protein (C-ERMAD domain), His tagged
Cat.No. : | EZR-17H |
Product Overview : | Recombinant Zebrafish EZR Protein (C-ERMAD domain) with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zebrafish |
Source : | E.coli |
Tag : | His |
Description : | The cytoplasmic peripheral membrane protein encoded by this gene functions as a protein-tyrosine kinase substrate in microvilli. As a member of the ERM protein family, this protein serves as an intermediate between the plasma membrane and the actin cytoskeleton. This protein plays a key role in cell surface structure adhesion, migration and organization, and it has been implicated in various human cancers. A pseudogene located on chromosome 3 has been identified for this gene. Alternatively spliced variants have also been described for this gene. |
Molecular Mass : | The protein has a calculated MW of 14 kDa. |
AA Sequence : | MHHHHHHHHHHMTAPPLPPPPPAYDHDENDLDDGEESNGSYTADLQTGGFNDHRLEEERITEAEKNERVQKQLLALTSELAQARDDTKKTQNDLLHTENVRAGRDKYKTLRQIRQGNTKQRI |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.11 mg/mL by BCA |
Storage Buffer : | Sterile 20 mM Tris, pH 8.0, 300 mM NaCl, 10% Glycerol |
Gene Name | EZR ezrin [ Homo sapiens (human) ] |
Official Symbol | EZR |
Synonyms | EZR; ezrin; CVL; CVIL; VIL2; HEL-S-105; ezrin; cytovillin 2; epididymis secretory protein Li 105; p81; villin 2 (ezrin) |
Gene ID | 7430 |
mRNA Refseq | NM_003379 |
Protein Refseq | NP_003370 |
MIM | 123900 |
UniProt ID | P15311 |
◆ Recombinant Proteins | ||
EZR-2173R | Recombinant Rat EZR Protein | +Inquiry |
EZR-8556H | Recombinant Human EZR protein(Pro2-Leu586), His-tagged | +Inquiry |
EZR-5402M | Recombinant Mouse EZR Protein | +Inquiry |
EZR-492H | Recombinant Human EZR Protein (1-251 aa), His-SUMO-tagged | +Inquiry |
EZR-17H | Recombinant Zebrafish EZR Protein (C-ERMAD domain), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EZR-6486HCL | Recombinant Human EZR 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All EZR Products
Required fields are marked with *
My Review for All EZR Products
Required fields are marked with *