Recombinant Human F2R Protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Human F2R Protein, GST-tagged

Recombinant Human F2R Protein, GST-tagged

F2R Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : F2R-3613H
Product Overview : Human F2R partial ORF ( NP_001983.1, 42 a.a. - 102 a.a.) recombinant protein with GST-tag at N-terminal.
Description : Coagulation factor II receptor is a 7-transmembrane receptor involved in the regulation of thrombotic response. Proteolytic cleavage leads to the activation of the receptor. F2R is a G-protein coupled receptor family member. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2015]
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 32.45 kDa
AA Sequence : SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : F2R coagulation factor II (thrombin) receptor [ Homo sapiens ]
Official Symbol : F2R
Synonyms : F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR; thrombin receptor; protease-activated receptor 1; coagulation factor II receptor; HTR; PAR-1;
Gene ID : 2149
mRNA Refseq : NM_001992
Protein Refseq : NP_001983
MIM : 187930
UniProt ID : P25116

Online Inquiry


  •  
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information
  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.