Recombinant Human F2R protein, His-tagged
| Cat.No. : | F2R-2730H |
| Product Overview : | Recombinant Human F2R protein(44-102 aa), fused to His tag, was expressed in E. coli. |
| Availability | May 22, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 44-102 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLT |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | F2R coagulation factor II (thrombin) receptor [ Homo sapiens ] |
| Official Symbol | F2R |
| Synonyms | F2R; coagulation factor II (thrombin) receptor; proteinase-activated receptor 1; CF2R; PAR 1; PAR1; TR; thrombin receptor; protease-activated receptor 1; coagulation factor II receptor; HTR; PAR-1; |
| Gene ID | 2149 |
| mRNA Refseq | NM_001992 |
| Protein Refseq | NP_001983 |
| MIM | 187930 |
| UniProt ID | P25116 |
| ◆ Recombinant Proteins | ||
| F2R-42H | Recombinant Human F2R Full length protein, Flag&Strep-tagged | +Inquiry |
| F2R-3613H | Recombinant Human F2R Protein, GST-tagged | +Inquiry |
| RFL16109HF | Recombinant Full Length Human Proteinase-Activated Receptor 1(F2R) Protein, His tagged | +Inquiry |
| F2r-2176R | Recombinant Rat F2r Protein, His-tagged | +Inquiry |
| F2R-367H | Recombinant Human F2R Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F2R-27H | Native Human F2R Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F2R-2116HCL | Recombinant Human F2R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F2R Products
Required fields are marked with *
My Review for All F2R Products
Required fields are marked with *
