Recombinant Human F9 protein, His-KSI-tagged
| Cat.No. : | F9-1299H |
| Product Overview : | Recombinant Human F9 protein(P00740)(144-239aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&KSI |
| Protein Length : | 144-239aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | FCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFP |
| Gene Name | F9 coagulation factor IX [ Homo sapiens ] |
| Official Symbol | F9 |
| Synonyms | F9; coagulation factor IX; Christmas disease; Factor IX; FIX; hemophilia B; plasma thromboplastic component; F9 p22; FIX F9; factor 9; factor IX F9; serine protease; Christmas factor; plasma thromboplastin component; P19; PTC; HEMB; THPH8; MGC129641; MGC129642; |
| Gene ID | 2158 |
| mRNA Refseq | NM_000133 |
| Protein Refseq | NP_000124 |
| MIM | 300746 |
| UniProt ID | P00740 |
| ◆ Recombinant Proteins | ||
| F9-3626H | Recombinant Human F9 Protein, GST-tagged | +Inquiry |
| F9-013H | Active Recombinant Human F9 Protein, His-tagged | +Inquiry |
| F9-12627H | Recombinant Human F9, His-tagged | +Inquiry |
| F9-4098H | Recombinant Full Length Human F9 Protein (Met1-Thr461), C-His tagged | +Inquiry |
| F9-915R | Recombinant Rabbit F9 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| F9-266B | Active Native Bovine Factor IX | +Inquiry |
| F9-301R | Native Rat Factor IXa | +Inquiry |
| F9-300R | Native Rat Factor IX | +Inquiry |
| F9-26523H | Active Native Human F9 Protein | +Inquiry |
| F9-671H | Native Human Coagulation Factor IX | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| F9-1849HCL | Recombinant Human F9 cell lysate | +Inquiry |
| F9-1768MCL | Recombinant Mouse F9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F9 Products
Required fields are marked with *
My Review for All F9 Products
Required fields are marked with *
