Recombinant Human F9 protein, His-KSI-tagged
Cat.No. : | F9-1299H |
Product Overview : | Recombinant Human F9 protein(P00740)(144-239aa), fused with N-terminal His and KSI tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&KSI |
Protein Length : | 144-239aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 42.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFP |
Gene Name | F9 coagulation factor IX [ Homo sapiens ] |
Official Symbol | F9 |
Synonyms | F9; coagulation factor IX; Christmas disease; Factor IX; FIX; hemophilia B; plasma thromboplastic component; F9 p22; FIX F9; factor 9; factor IX F9; serine protease; Christmas factor; plasma thromboplastin component; P19; PTC; HEMB; THPH8; MGC129641; MGC129642; |
Gene ID | 2158 |
mRNA Refseq | NM_000133 |
Protein Refseq | NP_000124 |
MIM | 300746 |
UniProt ID | P00740 |
◆ Recombinant Proteins | ||
F9-013H | Active Recombinant Human F9 Protein, His-tagged | +Inquiry |
F9-6926M | F9-6926M | +Inquiry |
F9-7808M | Recombinant Mouse F9 protein, His-tagged | +Inquiry |
RFL29862VF | Recombinant Full Length Vaccinia Virus Protein F9 (F9) Protein, His-Tagged | +Inquiry |
F9-2057H | Recombinant Full Length Human F9 Protein (Thr29-Thr461), C-His tagged | +Inquiry |
◆ Native Proteins | ||
F9-5405M | Native Mouse Coagulation Factor IX | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
F9-26523TH | Native Human F9 | +Inquiry |
F9-300R | Native Rat Factor IX | +Inquiry |
◆ Cell & Tissue Lysates | ||
F9-1768MCL | Recombinant Mouse F9 cell lysate | +Inquiry |
F9-1849HCL | Recombinant Human F9 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All F9 Products
Required fields are marked with *
My Review for All F9 Products
Required fields are marked with *