Recombinant Human FABP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | FABP1-6128H |
Product Overview : | FABP1 MS Standard C13 and N15-labeled recombinant protein (NP_001434) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. This protein and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. |
Molecular Mass : | 14.2 kDa |
AA Sequence : | MSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | FABP1 fatty acid binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | FABP1 |
Synonyms | FABP1; fatty acid binding protein 1, liver; fatty acid-binding protein, liver; L FABP; fatty acid-binding protein 1; liver-type fatty acid-binding protein; FABPL; L-FABP; |
Gene ID | 2168 |
mRNA Refseq | NM_001443 |
Protein Refseq | NP_001434 |
MIM | 134650 |
UniProt ID | P07148 |
◆ Recombinant Proteins | ||
Fabp1-7126M | Recombinant Mouse Fabp1 protein, His & T7-tagged | +Inquiry |
FABP1-247H | Recombinant Human FABP1 Protein | +Inquiry |
FABP1-7124C | Recombinant Cattle FABP1 protein, His-tagged | +Inquiry |
FABP1-657H | Recombinant Human FABP1 protein, MYC/DDK-tagged, C13/N15-labeled | +Inquiry |
FABP1-5766C | Recombinant Chicken FABP1 | +Inquiry |
◆ Native Proteins | ||
FABP1-509H | Native Human FABP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FABP1-6479HCL | Recombinant Human FABP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FABP1 Products
Required fields are marked with *
My Review for All FABP1 Products
Required fields are marked with *