Recombinant Human FADS3
| Cat.No. : | FADS3-28818TH |
| Product Overview : | Recombinant fragment of Human FADS3 with N terminal proprietary tag. Predicted MW 36.41 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 98 amino acids |
| Description : | The protein encoded by this gene is a member of the fatty acid desaturase (FADS) gene family. Desaturase enzymes regulate unsaturation of fatty acids through the introduction of double bonds between defined carbons of the fatty acyl chain. FADS family members are considered fusion products composed of an N-terminal cytochrome b5-like domain and a C-terminal multiple membrane-spanning desaturase portion, both of which are characterized by conserved histidine motifs. This gene is clustered with family members FADS1 and FADS2 at 11q12-q13.1; this cluster is thought to have arisen evolutionarily from gene duplication based on its similar exon/intron organization. |
| Molecular Weight : | 36.410kDa inclusive of tags |
| Tissue specificity : | Has been found in heart, liver, lung, uterus, and brainstem. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | PGAPLPTFCWEQIRAHDQPGDKWLVIERRVYDISRWAQRHPGGSRLIGHHGAEDATDAFRAFHQDLNFVRKFLQPLLIGELAPEEPSQDGPLNAQLVE |
| Sequence Similarities : | Belongs to the fatty acid desaturase family.Contains 1 cytochrome b5 heme-binding domain. |
| Gene Name | FADS3 fatty acid desaturase 3 [ Homo sapiens ] |
| Official Symbol | FADS3 |
| Synonyms | FADS3; fatty acid desaturase 3; LLCDL3; CYB5RP; delta 9 desaturase; |
| Gene ID | 3995 |
| mRNA Refseq | NM_021727 |
| Protein Refseq | NP_068373 |
| MIM | 606150 |
| Uniprot ID | Q9Y5Q0 |
| Chromosome Location | 11q12-q13.1 |
| Pathway | Fatty acid, triacylglycerol, and ketone body metabolism, organism-specific biosystem; Metabolism of lipids and lipoproteins, organism-specific biosystem; Regulation of Lipid Metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha), organism-specific biosystem; |
| Function | heme binding; molecular_function; oxidoreductase activity; oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water; |
| ◆ Recombinant Proteins | ||
| FADS3-226H | Recombinant Human FADS3 Protein, His-tagged | +Inquiry |
| RFL15854HF | Recombinant Full Length Human Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged | +Inquiry |
| RFL14228BF | Recombinant Full Length Bovine Fatty Acid Desaturase 3(Fads3) Protein, His-Tagged | +Inquiry |
| FADS3-1807H | Recombinant Human FADS3 protein, GST-tagged | +Inquiry |
| FADS3-28818TH | Recombinant Human FADS3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FADS3-6471HCL | Recombinant Human FADS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FADS3 Products
Required fields are marked with *
My Review for All FADS3 Products
Required fields are marked with *



