Recombinant Human FAM3B Protein, GST-tagged

Cat.No. : FAM3B-3752H
Product Overview : Human FAM3B full-length ORF ( AAH57829.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FAM3B (Family With Sequence Similarity 3 Member B) is a Protein Coding gene. Diseases associated with FAM3B include Reticulate Acropigmentation Of Kitamura and Voyeurism. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3C.
Molecular Mass : 51.59 kDa
AA Sequence : MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FAM3B family with sequence similarity 3, member B [ Homo sapiens ]
Official Symbol FAM3B
Synonyms FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11;
Gene ID 54097
mRNA Refseq NM_058186
Protein Refseq NP_478066
MIM 608617
UniProt ID P58499

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FAM3B Products

Required fields are marked with *

My Review for All FAM3B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon