Recombinant Human FAM3B Protein, GST-tagged
| Cat.No. : | FAM3B-3752H |
| Product Overview : | Human FAM3B full-length ORF ( AAH57829.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | FAM3B (Family With Sequence Similarity 3 Member B) is a Protein Coding gene. Diseases associated with FAM3B include Reticulate Acropigmentation Of Kitamura and Voyeurism. GO annotations related to this gene include cytokine activity. An important paralog of this gene is FAM3C. |
| Molecular Mass : | 51.59 kDa |
| AA Sequence : | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FAM3B family with sequence similarity 3, member B [ Homo sapiens ] |
| Official Symbol | FAM3B |
| Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; |
| Gene ID | 54097 |
| mRNA Refseq | NM_058186 |
| Protein Refseq | NP_478066 |
| MIM | 608617 |
| UniProt ID | P58499 |
| ◆ Recombinant Proteins | ||
| Fam3b-4746M | Recombinant Mouse Fam3b protein(30-235aa), His&Myc-tagged | +Inquiry |
| FAM3B-319H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry |
| Fam3b-6444M | Recombinant Mouse Fam3b protein, His-tagged | +Inquiry |
| FAM3B-750H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry |
| FAM3B-97H | Recombinant Human FAM3B protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *
