Recombinant Human FAM3B protein, His-tagged
| Cat.No. : | FAM3B-7845H | 
| Product Overview : | Recombinant Human FAM3B protein(60-235 aa), fused with N-terminal His tag, was expressed in E. coli. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 60-235 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. | 
| AA Sequence : | RQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS | 
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Official Symbol | FAM3B | 
| Synonyms | FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11; | 
| Gene ID | 54097 | 
| mRNA Refseq | NM_058186 | 
| Protein Refseq | NP_478066 | 
| MIM | 608617 | 
| UniProt ID | P58499 | 
| ◆ Recombinant Proteins | ||
| FAM3B-3657H | Recombinant Human FAM3B Protein (Glu30-Ser187), N-His tagged | +Inquiry | 
| FAM3B-4583HF | Recombinant Full Length Human FAM3B Protein, GST-tagged | +Inquiry | 
| FAM3B-97H | Recombinant Human FAM3B protein | +Inquiry | 
| Fam3b-4246M | Recombinant Mouse Fam3b protein, hFc-tagged | +Inquiry | 
| FAM3B-319H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FAM3B Products
Required fields are marked with *
My Review for All FAM3B Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            