Recombinant Mouse Fam3b protein(30-235aa), His&Myc-tagged
Cat.No. : | Fam3b-4746M |
Product Overview : | Recombinant Mouse Fam3b protein(Q9D309)(30-235aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 30-235aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ELIPDVPLSSTLYNIRSIGERPVLKAPAPKRQKCDHWSPCPPDTYAYRLLSGGGRDKYAKICFEDEVLIGEKTGNVARGINIAVVNYETGKVIATKYFDMYEGDNSGPMAKFIQSTPSKSLLFMVTHDDGSSKLKAQAKDAIEALGSKEIKNMKFRSSWVFVAAKGFELPSEIEREKINHSDQSRNRYAGWPAEIQIEGCIPKGLR |
Gene Name | Fam3b family with sequence similarity 3, member B [ Mus musculus ] |
Official Symbol | Fam3b |
Synonyms | FAM3B; family with sequence similarity 3, member B; protein FAM3B; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; ORF9; Pander; D16Jhu19e; 9030624C24Rik; |
Gene ID | 52793 |
mRNA Refseq | NM_020622 |
Protein Refseq | NP_065647 |
◆ Recombinant Proteins | ||
Fam3b-6444M | Recombinant Mouse Fam3b protein, His-tagged | +Inquiry |
Fam3b-4247M | Recombinant Mouse Fam3b protein, His&Myc-tagged | +Inquiry |
FAM3B-750H | Recombinant Human FAM3B Protein, Fc-tagged | +Inquiry |
FAM3B-3657H | Recombinant Human FAM3B Protein (Glu30-Ser187), N-His tagged | +Inquiry |
FAM3B-7845H | Recombinant Human FAM3B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM3B-1648HCL | Recombinant Human FAM3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fam3b Products
Required fields are marked with *
My Review for All Fam3b Products
Required fields are marked with *