Recombinant Human FAM3B protein, His&Myc-tagged

• Cat.No.: FAM3B-4342H
• Product Overview: Recombinant Human FAM3B protein(P58499)(30-235aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His&C-Myc
• Protein length: 30-235aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.3 kDa
• AASequence: ELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: FAM3B family with sequence similarity 3, member B [ Homo sapiens ]
• Official Symbol: FAM3B
• Synonyms: FAM3B; family with sequence similarity 3, member B; C21orf11, chromosome 21 open reading frame 11; protein FAM3B; 2 21; C21orf76; D21M16SJHU19e; ORF9; PRED44; pancreatic derived factor; pancreatic-derived factor; cytokine-like protein 2-21; 2-21; PANDER; C21orf11
• Gene ID: 54097
• mRNA Refseq: NM_058186
• Protein Refseq: NP_478066
• MIM: 608617
• UniProt ID: P58499