Recombinant Human FAM9C Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FAM9C-2130H
• Product Overview: FAM9C MS Standard C13 and N15-labeled recombinant protein (NP_777561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is a member of a gene family which arose through duplication on the X chromosome. The encoded protein may be localized to the nucleus as the protein contains several nuclear localization signals, and has similarity to a synaptonemal complex protein.
• Molecular Mass: 19.2 kDa
• AA Sequence: MAAKDQLEVQVMAAQEMELAGKDPVSHEHEERKPVTETKEGDVTDEHGERGSFAETDEHTGVDTKELEDIAADIKEHLAAKRKRIEKIAKACSEIKNRIKNVLRTTQLKRQKRDYRISLKLPNVLEEFITDEQKDEEGDGEKEEQIKIFQEQQKRWQQDGKGTERDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FAM9C family with sequence similarity 9 member C [ Homo sapiens (human) ]
• Official Symbol: FAM9C
• Synonyms: FAM9C; family with sequence similarity 9 member C; TEX39C; protein FAM9C; testis expressed 39C
• Gene ID: 171484
• mRNA Refseq: NM_174901
• Protein Refseq: NP_777561
• MIM: 300479
• UniProt ID: Q8IZT9