Recombinant Human FASLG Protein, His-tagged
Cat.No. : | FASLG-244H |
Product Overview : | Recombinant human FASLG protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 281 |
Description : | This gene is a member of the tumor necrosis factor superfamily. The primary function of the encoded transmembrane protein is the induction of apoptosis triggered by binding to FAS. The FAS/FASLG signaling pathway is essential for immune system regulation, including activation-induced cell death (AICD) of T cells and cytotoxic T lymphocyte induced cell death. It has also been implicated in the progression of several cancers. Defects in this gene may be related to some cases of systemic lupus erythematosus (SLE). Alternatively spliced transcript variants have been described. |
Form : | Lyophilized |
Molecular Mass : | 17.7 kDa |
AA Sequence : | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | FASLG Fas ligand (TNF superfamily, member 6) [ Homo sapiens (human) ] |
Official Symbol | FASLG |
Synonyms | FASLG; Fas ligand (TNF superfamily, member 6); APT1LG1, TNFSF6, tumor necrosis factor (ligand) superfamily, member 6; tumor necrosis factor ligand superfamily member 6; CD178; FasL; APTL; CD95 ligand; fas antigen ligand; apoptosis antigen ligand; apoptosis (APO-1) antigen ligand 1; tumor necrosis factor (ligand) superfamily, member 6; FASL; CD95L; CD95-L; TNFSF6; APT1LG1; |
Gene ID | 356 |
mRNA Refseq | NM_000639 |
Protein Refseq | NP_000630 |
MIM | 134638 |
UniProt ID | P48023 |
◆ Recombinant Proteins | ||
FASLG-1931R | Recombinant Rat FASLG Protein, His (Fc)-Avi-tagged | +Inquiry |
FASLG-234H | Recombinant Human FASLG, C13&N15-labeled | +Inquiry |
FASLG-3855H | Recombinant Human FASLG Protein | +Inquiry |
FASLG-2884H | Recombinant Human FASLG protein, His-tagged | +Inquiry |
FASLG-3857H | Recombinant Human FASLG Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASLG-6324HCL | Recombinant Human FASLG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASLG Products
Required fields are marked with *
My Review for All FASLG Products
Required fields are marked with *
0
Inquiry Basket