Recombinant Human FASN, His-tagged
Cat.No. : | FASN-28809TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 2181-2502 of Human Fatty Acid Synthase with an N terminal His tag; MWt 37 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2181-2502 a.a. |
Description : | The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. |
Conjugation : | HIS |
Tissue specificity : | Ubiquitous. Prominent expression in brain, lung, and liver. |
Form : | Lyophilised:Reconstitute with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFH SLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQV QPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSL FLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLD RQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGS GLESIISIIHSSLA |
Sequence Similarities : | Contains 1 acyl carrier domain. |
Gene Name | FASN fatty acid synthase [ Homo sapiens ] |
Official Symbol | FASN |
Synonyms | FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1; |
Gene ID | 2194 |
mRNA Refseq | NM_004104 |
Protein Refseq | NP_004095 |
MIM | 600212 |
Uniprot ID | P49327 |
Chromosome Location | 17q25 |
Pathway | ChREBP activates metabolic gene expression, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, conserved biosystem; |
Function | 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity; [acyl-carrier-protein] S-; |
◆ Recombinant Proteins | ||
Fasn-3277MFL | Recombinant Full Length Mouse Fasn protein, Flag-tagged | +Inquiry |
FASN-718H | Recombinant Human FASN Protein, His/GST-tagged | +Inquiry |
FASN-2924H | Recombinant Human FASN Protein, His (Fc)-Avi-tagged | +Inquiry |
Fasn-596M | Recombinant Mouse Fasn protein, His/Myc-tagged | +Inquiry |
fasn-2181Z | Recombinant Zebrafish fasn Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASN-597HCL | Recombinant Human FASN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FASN Products
Required fields are marked with *
My Review for All FASN Products
Required fields are marked with *