Recombinant Human FASN, His-tagged

Cat.No. : FASN-28809TH
Product Overview : Recombinant fragment, corresponding to amino acids 2181-2502 of Human Fatty Acid Synthase with an N terminal His tag; MWt 37 kDa
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2181-2502 a.a.
Description : The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Conjugation : HIS
Tissue specificity : Ubiquitous. Prominent expression in brain, lung, and liver.
Form : Lyophilised:Reconstitute with 64 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLR SLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFH SLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQV QPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSL FLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLD RQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKT GGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGS GLESIISIIHSSLA
Sequence Similarities : Contains 1 acyl carrier domain.
Gene Name FASN fatty acid synthase [ Homo sapiens ]
Official Symbol FASN
Synonyms FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1;
Gene ID 2194
mRNA Refseq NM_004104
Protein Refseq NP_004095
MIM 600212
Uniprot ID P49327
Chromosome Location 17q25
Pathway ChREBP activates metabolic gene expression, organism-specific biosystem; Fatty Acid Biosynthesis, organism-specific biosystem; Fatty Acyl-CoA Biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, organism-specific biosystem; Fatty acid biosynthesis, conserved biosystem;
Function 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity; [acyl-carrier-protein] S-;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FASN Products

Required fields are marked with *

My Review for All FASN Products

Required fields are marked with *

0

Inquiry Basket

cartIcon