Recombinant Human FASN protein, GST-tagged
Cat.No. : | FASN-30158H |
Product Overview : | Recombinant Human FASN (139-439 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ala139-Gly439 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | FASN fatty acid synthase [ Homo sapiens ] |
Official Symbol | FASN |
Synonyms | FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1; short chain dehydrogenase/reductase family 27X, member 1; OA-519; MGC14367; MGC15706; |
Gene ID | 2194 |
mRNA Refseq | NM_004104 |
Protein Refseq | NP_004095 |
MIM | 600212 |
UniProt ID | P49327 |
◆ Recombinant Proteins | ||
FASN-717C | Recombinant Chicken FASN Protein, His-tagged | +Inquiry |
FASN-2661H | Recombinant Human FASN protein, His-tagged | +Inquiry |
fasn-2181Z | Recombinant Zebrafish fasn Protein, His-tagged | +Inquiry |
FASN-1932R | Recombinant Rat FASN Protein, His (Fc)-Avi-tagged | +Inquiry |
FASN-2924H | Recombinant Human FASN Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FASN-597HCL | Recombinant Human FASN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FASN Products
Required fields are marked with *
My Review for All FASN Products
Required fields are marked with *
0
Inquiry Basket