Recombinant Human FCER2 Protein, GST-tagged
| Cat.No. : | FCER2-3985H |
| Product Overview : | Human FCER2 full-length ORF ( AAH14108, 1 a.a. - 321 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] |
| Molecular Mass : | 61.05 kDa |
| AA Sequence : | MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FCER2 Fc fragment of IgE, low affinity II, receptor for (CD23) [ Homo sapiens ] |
| Official Symbol | FCER2 |
| Synonyms | FCER2; Fc fragment of IgE, low affinity II, receptor for (CD23); CD23A, Fc fragment of IgE, low affinity II, receptor for (CD23A) , FCE2; low affinity immunoglobulin epsilon Fc receptor; CD23; CLEC4J; BLAST-2; CD23 antigen; fc-epsilon-RII; lymphocyte IgE receptor; immunoglobulin E-binding factor; C-type lectin domain family 4, member J; FCE2; CD23A; IGEBF; |
| Gene ID | 2208 |
| mRNA Refseq | NM_001207019 |
| Protein Refseq | NP_001193948 |
| MIM | 151445 |
| UniProt ID | P06734 |
| ◆ Recombinant Proteins | ||
| FCER2-539H | Recombinant Human FCER2 Protein | +Inquiry |
| FCER2-4730HF | Recombinant Full Length Human FCER2 Protein | +Inquiry |
| FCER2-27253TH | Recombinant Human FCER2 protein | +Inquiry |
| Fcer2-664R | Recombinant Rat Fcer2 Protein, His-tagged | +Inquiry |
| FCER2-343RAF647 | Recombinant Rat Fcer2 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCER2-1814HCL | Recombinant Human FCER2 cell lysate | +Inquiry |
| FCER2-1023RCL | Recombinant Rat FCER2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCER2 Products
Required fields are marked with *
My Review for All FCER2 Products
Required fields are marked with *
