Recombinant Human FCN2 Protein (26-313 aa), His-tagged

• Cat.No.: FCN2-2138H
• Product Overview: Recombinant Human FCN2 Protein (26-313 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 26-313 aa
• Description: May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.4 kDa
• AA Sequence: LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ]
• Official Symbol: FCN2
• Synonyms: FCN2; ficolin-2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; EBP-37
• Gene ID: 2220
• mRNA Refseq: NM_004108
• Protein Refseq: NP_004099
• MIM: 601624
• UniProt ID: Q15485