Recombinant Human FCN2 Protein (26-313 aa), His-tagged
Cat.No. : | FCN2-2138H |
Product Overview : | Recombinant Human FCN2 Protein (26-313 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 26-313 aa |
Description : | May function in innate immunity through activation of the lectin complement pathway. Calcium-dependent and GlcNAc-binding lectin. Enhances phagocytosis of S.typhimurium by neutrophils, suggesting an opsonic effect via the collagen region. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.4 kDa |
AA Sequence : | LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ] |
Official Symbol | FCN2 |
Synonyms | FCN2; ficolin-2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; EBP-37; |
Gene ID | 2220 |
mRNA Refseq | NM_004108 |
Protein Refseq | NP_004099 |
MIM | 601624 |
UniProt ID | Q15485 |
◆ Recombinant Proteins | ||
FCN2-1682R | Recombinant Rhesus monkey FCN2 Protein, His-tagged | +Inquiry |
FCN2-4003H | Recombinant Human FCN2 Protein, GST-tagged | +Inquiry |
FCN2-494H | Active Recombinant Human Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin), His-tagged | +Inquiry |
FCN2-2138H | Recombinant Human FCN2 Protein (26-313 aa), His-tagged | +Inquiry |
FCN2-4765HF | Recombinant Full Length Human FCN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN2-613HCL | Recombinant Human FCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN2 Products
Required fields are marked with *
My Review for All FCN2 Products
Required fields are marked with *
0
Inquiry Basket