Recombinant Human FCN2 protein, His-tagged
Cat.No. : | FCN2-4411H |
Product Overview : | Recombinant Human FCN2 protein(Q15485)(26-313aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 26-313aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.4 kDa |
AA Sequence : | LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ] |
Official Symbol | FCN2 |
Synonyms | FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37; |
Gene ID | 2220 |
mRNA Refseq | NM_004108 |
Protein Refseq | NP_004099 |
MIM | 601624 |
UniProt ID | Q15485 |
◆ Recombinant Proteins | ||
FCN2-2138H | Recombinant Human FCN2 Protein (26-313 aa), His-tagged | +Inquiry |
FCN2-4765HF | Recombinant Full Length Human FCN2 Protein, GST-tagged | +Inquiry |
FCN2-4542H | Recombinant Human FCN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FCN2-4411H | Recombinant Human FCN2 protein, His-tagged | +Inquiry |
FCN2-1682R | Recombinant Rhesus monkey FCN2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN2-613HCL | Recombinant Human FCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN2 Products
Required fields are marked with *
My Review for All FCN2 Products
Required fields are marked with *