Recombinant Human FCN2 protein, His-tagged
| Cat.No. : | FCN2-4411H |
| Product Overview : | Recombinant Human FCN2 protein(Q15485)(26-313aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 26-313aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 35.4 kDa |
| AA Sequence : | LQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ] |
| Official Symbol | FCN2 |
| Synonyms | FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37; |
| Gene ID | 2220 |
| mRNA Refseq | NM_004108 |
| Protein Refseq | NP_004099 |
| MIM | 601624 |
| UniProt ID | Q15485 |
| ◆ Recombinant Proteins | ||
| FCN2-4003H | Recombinant Human FCN2 Protein, GST-tagged | +Inquiry |
| FCN2-4411H | Recombinant Human FCN2 protein, His-tagged | +Inquiry |
| FCN2-494H | Active Recombinant Human Ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin), His-tagged | +Inquiry |
| FCN2-1504R | Recombinant Rhesus Macaque FCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCN2-2138H | Recombinant Human FCN2 Protein (26-313 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCN2-613HCL | Recombinant Human FCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN2 Products
Required fields are marked with *
My Review for All FCN2 Products
Required fields are marked with *
