Recombinant Human FCN2 Protein, GST-tagged
Cat.No. : | FCN2-4003H |
Product Overview : | Human FCN2 full-length ORF ( NP_004099.2, 1 a.a. - 313 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 60.4 kDa |
AA Sequence : | MELDRAVGVLGAATLLLSFLGMAWALQAADTCPEVKMVGLEGSDKLTILRGCPGLPGAPGPKGEAGTNGKRGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FCN2 ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin) [ Homo sapiens ] |
Official Symbol | FCN2 |
Synonyms | FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37; |
Gene ID | 2220 |
mRNA Refseq | NM_004108 |
Protein Refseq | NP_004099 |
MIM | 601624 |
UniProt ID | Q15485 |
◆ Recombinant Proteins | ||
FCN2-2936H | Recombinant Human FCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCN2-1504R | Recombinant Rhesus Macaque FCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
FCN2-2138H | Recombinant Human FCN2 Protein (26-313 aa), His-tagged | +Inquiry |
FCN2-1682R | Recombinant Rhesus monkey FCN2 Protein, His-tagged | +Inquiry |
FCN2-4003H | Recombinant Human FCN2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCN2-613HCL | Recombinant Human FCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FCN2 Products
Required fields are marked with *
My Review for All FCN2 Products
Required fields are marked with *
0
Inquiry Basket