Recombinant Human FCN2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FCN2-4542H |
| Product Overview : | FCN2 MS Standard C13 and N15-labeled recombinant protein (NP_056652) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Mass : | 30.23 kDa |
| AA Sequence : | MELDRAVGVLGAATLLLSFLGMAWALQAADTCPGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FCN2 ficolin 2 [ Homo sapiens (human) ] |
| Official Symbol | FCN2 |
| Synonyms | FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37; |
| Gene ID | 2220 |
| mRNA Refseq | NM_015837 |
| Protein Refseq | NP_056652 |
| MIM | 601624 |
| UniProt ID | Q15485 |
| ◆ Recombinant Proteins | ||
| FCN2-2138H | Recombinant Human FCN2 Protein (26-313 aa), His-tagged | +Inquiry |
| FCN2-4765HF | Recombinant Full Length Human FCN2 Protein, GST-tagged | +Inquiry |
| FCN2-2936H | Recombinant Human FCN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FCN2-1475H | Recombinant Human FCN2 Protein, His-tagged | +Inquiry |
| FCN2-4542H | Recombinant Human FCN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FCN2-613HCL | Recombinant Human FCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCN2 Products
Required fields are marked with *
My Review for All FCN2 Products
Required fields are marked with *



