Recombinant Human FCN2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : FCN2-4542H
Product Overview : FCN2 MS Standard C13 and N15-labeled recombinant protein (NP_056652) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Mass : 30.23 kDa
AA Sequence : MELDRAVGVLGAATLLLSFLGMAWALQAADTCPGERGPPGPPGKAGPPGPNGAPGEPQPCLTGPRTCKDLLDRGHFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRVDGSVDFYRDWATYKQGFGSRLGEFWLGNDNIHALTAQGTSELRVDLVDFEDNYQFAKYRSFKVADEAEKYNLVLGAFVEGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANGINWKSGKGYNYSYKVSEMKVRPATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name FCN2 ficolin 2 [ Homo sapiens (human) ]
Official Symbol FCN2
Synonyms FCN2; ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin); ficolin-2; collagen/fibrinogen domain containing protein 2; EBP 37; FCNL; ficolin B; ficolin 2; hucolin; L ficolin; P35; serum lectin p35; L-ficolin; ficolin-B; ficolin-beta; 37 kDa elastin-binding protein; collagen/fibrinogen domain-containing protein 2; EBP-37;
Gene ID 2220
mRNA Refseq NM_015837
Protein Refseq NP_056652
MIM 601624
UniProt ID Q15485

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCN2 Products

Required fields are marked with *

My Review for All FCN2 Products

Required fields are marked with *

0
cart-icon
0
compare icon