Recombinant Human FCRL6 Protein (20-307 aa), His-tagged
| Cat.No. : | FCRL6-1860H |
| Product Overview : | Recombinant Human FCRL6 Protein (20-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 20-307 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 33.7 kDa |
| AA Sequence : | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | FCRL6 Fc receptor-like 6 [ Homo sapiens ] |
| Official Symbol | FCRL6 |
| Synonyms | FCRL6; Fc receptor-like 6; FcRH6; FLJ16056; IFGP6; fcR-like protein 6; |
| Gene ID | 343413 |
| mRNA Refseq | NM_001004310 |
| Protein Refseq | NP_001004310 |
| MIM | 613562 |
| UniProt ID | Q6DN72 |
| ◆ Recombinant Proteins | ||
| FCRL6-1211H | Recombinant Human FCRL6 Protein, His-tagged | +Inquiry |
| FCRL6-1860H | Recombinant Human FCRL6 Protein (20-307 aa), His-tagged | +Inquiry |
| FCRL6-5105H | Recombinant Human FCRL6 protein, His-tagged | +Inquiry |
| RFL8420MF | Recombinant Full Length Mouse Fc Receptor-Like Protein 6(Fcrl6) Protein, His-Tagged | +Inquiry |
| FCRL6-2767H | Recombinant Human FCRL6 Protein (20-307 aa), His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCRL6 Products
Required fields are marked with *
My Review for All FCRL6 Products
Required fields are marked with *
