Recombinant Human FCRL6 Protein (20-307 aa), His-tagged
Cat.No. : | FCRL6-1860H |
Product Overview : | Recombinant Human FCRL6 Protein (20-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 20-307 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 33.7 kDa |
AA Sequence : | LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | FCRL6 Fc receptor-like 6 [ Homo sapiens ] |
Official Symbol | FCRL6 |
Synonyms | FCRL6; Fc receptor-like 6; FcRH6; FLJ16056; IFGP6; fcR-like protein 6; |
Gene ID | 343413 |
mRNA Refseq | NM_001004310 |
Protein Refseq | NP_001004310 |
MIM | 613562 |
UniProt ID | Q6DN72 |
◆ Recombinant Proteins | ||
FCRL6-2767H | Recombinant Human FCRL6 Protein (20-307 aa), His-tagged | +Inquiry |
FCRL6-1860H | Recombinant Human FCRL6 Protein (20-307 aa), His-tagged | +Inquiry |
FCRL6-1211H | Recombinant Human FCRL6 Protein, His-tagged | +Inquiry |
FCRL6-5105H | Recombinant Human FCRL6 protein, His-tagged | +Inquiry |
RFL8420MF | Recombinant Full Length Mouse Fc Receptor-Like Protein 6(Fcrl6) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FCRL6 Products
Required fields are marked with *
My Review for All FCRL6 Products
Required fields are marked with *
0
Inquiry Basket