Recombinant Human FCRL6 Protein (20-307 aa), His-tagged

• Cat.No.: FCRL6-1860H
• Product Overview: Recombinant Human FCRL6 Protein (20-307 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 20-307 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 33.7 kDa
• AA Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: FCRL6 Fc receptor-like 6 [ Homo sapiens ]
• Official Symbol: FCRL6
• Synonyms: FCRL6; Fc receptor-like 6; FcRH6; FLJ16056; IFGP6; fcR-like protein 6
• Gene ID: 343413
• mRNA Refseq: NM_001004310
• Protein Refseq: NP_001004310
• MIM: 613562
• UniProt ID: Q6DN72