Recombinant Human FCRL6 Protein, His-tagged

Cat.No. : FCRL6-1211H
Product Overview : Recombinant Human FCRL6 Protein (20-307aa) was expressed in E. coli with N-terminal His tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 20-307 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 35.7 kDa
AA Sequence : LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name FCRL6 Fc receptor like 6 [ Homo sapiens (human) ]
Official Symbol FCRL6
Synonyms FcRH6; FCRL6; Fc receptor-like protein 6; FcR-like protein 6; IFGP6; FcRH6; Fc receptor homolog 6
Gene ID 343413
mRNA Refseq NM_001004310.2
Protein Refseq NP_001004310.2
MIM 613562
UniProt ID Q6DN72

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCRL6 Products

Required fields are marked with *

My Review for All FCRL6 Products

Required fields are marked with *

0
cart-icon
0
compare icon