Recombinant Human FCRL6 Protein (20-307 aa), His-tagged

Cat.No. : FCRL6-2767H
Product Overview : Recombinant Human FCRL6 Protein (20-307 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 20-307 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 34.2 kDa
AA Sequence : LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name FCRL6 Fc receptor-like 6 [ Homo sapiens ]
Official Symbol FCRL6
Synonyms FCRL6; Fc receptor-like 6; Fc receptor-like protein 6; FcRH6; FLJ16056; IFGP6; fcR-like protein 6; leukocyte receptor;
Gene ID 343413
mRNA Refseq NM_001004310
Protein Refseq NP_001004310
MIM 613562
UniProt ID Q6DN72

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FCRL6 Products

Required fields are marked with *

My Review for All FCRL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon