Recombinant Human FECH Protein, GST-tagged
Cat.No. : | FECH-4065H |
Product Overview : | Human FECH full-length ORF ( NP_000131, 1 a.a. - 423 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is localized to the mitochondrion, where it catalyzes the insertion of the ferrous form of iron into protoporphyrin IX in the heme synthesis pathway. Mutations in this gene are associated with erythropoietic protoporphyria. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
Molecular Mass : | 72.16 kDa |
AA Sequence : | MRSLGANMAAALRAAGVLLRDPLASSSWRVCQPWRWKSGAAAAAVTTETAQHAQGAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDQDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FECH ferrochelatase [ Homo sapiens ] |
Official Symbol | FECH |
Synonyms | FECH; ferrochelatase; ferrochelatase (protoporphyria); ferrochelatase, mitochondrial; protoporphyria; heme synthase; heme synthetase; protoheme ferro-lyase; EPP; FCE; |
Gene ID | 2235 |
mRNA Refseq | NM_000140 |
Protein Refseq | NP_000131 |
MIM | 612386 |
UniProt ID | P22830 |
◆ Recombinant Proteins | ||
FECH-1762HFL | Recombinant Full Length Human FECH Protein, C-Flag-tagged | +Inquiry |
FECH-1007H | Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FECH-5770C | Recombinant Chicken FECH | +Inquiry |
FECH-2899B | Recombinant Bovine FECH protein, His-SUMO & Myc-tagged | +Inquiry |
Fech-2984M | Recombinant Mouse Fech Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FECH Products
Required fields are marked with *
My Review for All FECH Products
Required fields are marked with *