Recombinant Human FECH protein, His&Myc-tagged
Cat.No. : | FECH-4535H |
Product Overview : | Recombinant Human FECH protein(P22830)(55-423aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 55-423aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GAKPQVQPQKRKPKTGILMLNMGGPETLGDVHDFLLRLFLDRDLMTLPIQNKLAPFIAKRRTPKIQEQYRRIGGGSPIKIWTSKQGEGMVKLLDELSPNTAPHKYYIGFRYVHPLTEEAIEEMERDGLERAIAFTQYPQYSCSTTGSSLNAIYRYYNQVGRKPTMKWSTIDRWPTHHLLIQCFADHILKELDHFPLEKRSEVVILFSAHSLPMSVVNRGDPYPQEVSATVQKVMERLEYCNPYRLVWQSKVGPMPWLGPQTDESIKGLCERGRKNILLVPIAFTSDHIETLYELDIEYSQVLAKECGVENIRRAESLNGNPLFSKALADLVHSHIQSNELCSKQLTLSCPLCVNPVCRETKSFFTSQQL |
Gene Name | FECH ferrochelatase [ Homo sapiens ] |
Official Symbol | FECH |
Synonyms | FECH; ferrochelatase; ferrochelatase (protoporphyria); ferrochelatase, mitochondrial; protoporphyria; heme synthase; heme synthetase; protoheme ferro-lyase; EPP; FCE; |
Gene ID | 2235 |
mRNA Refseq | NM_000140 |
Protein Refseq | NP_000131 |
MIM | 612386 |
UniProt ID | P22830 |
◆ Recombinant Proteins | ||
FECH-2604H | Recombinant Human FECH Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FECH-5770C | Recombinant Chicken FECH | +Inquiry |
FECH-4535H | Recombinant Human FECH protein, His&Myc-tagged | +Inquiry |
FECH-905H | Recombinant Human FECH Protein, His (Fc)-Avi-tagged | +Inquiry |
FECH-01H | Recombinant human FECH protein, C-Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FECH-6267HCL | Recombinant Human FECH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FECH Products
Required fields are marked with *
My Review for All FECH Products
Required fields are marked with *