Recombinant Human FGF1 Protein
Cat.No. : | FGF1-81H |
Product Overview : | Recombinant Human FGF1 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. |
Molecular Mass : | 16 kDa |
AA Sequence : | MGFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Purity : | > 95% by SDS-PAGE |
Applications : | Optimal concentration for the desired application should be determined by the user. |
Quality Control Test : | Verified by disulfide mapping and Mass Spectrometry analysis. |
Storage : | Avoid repeated freeze-thaw cycles. 12 months at -20 centigrade. |
Storage Buffer : | 1 M ammonium formate buffer at pH 6.0, sterile filtered through a 0.2 micron filter |
Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens (human) ] |
Official Symbol | FGF1 |
Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha |
Gene ID | 2246 |
mRNA Refseq | NM_000800 |
Protein Refseq | NP_000791 |
MIM | 131220 |
UniProt ID | P05230 |
◆ Recombinant Proteins | ||
FGF1-161H | Active Recombinant Human FGF1 Protein | +Inquiry |
FGF1-2903H | Recombinant Human FGF1 protein, His-tagged | +Inquiry |
FGF1-322H | Recombinant Human FGF1 protein | +Inquiry |
Fgf1-634M | Active Recombinant Mouse Fgf1 | +Inquiry |
FGF1-4H | Active Recombinant Human Acidic Fibroblast Growth Factor | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *