Recombinant Human FGF1 protein, His-SUMO-tagged
| Cat.No. : | FGF1-2902H |
| Product Overview : | Recombinant Human FGF1 protein(P05230)(16-155aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 16-155aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 31.8 kDa |
| AA Sequence : | FNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FGF1 fibroblast growth factor 1 (acidic) [ Homo sapiens ] |
| Official Symbol | FGF1 |
| Synonyms | FGF1; fibroblast growth factor 1 (acidic); FGFA; fibroblast growth factor 1; AFGF; ECGF; ECGF beta; ECGFA; ECGFB; endothelial cell growth factor; alpha; beta; FGF alpha; GLIO703; HBGF1; heparin binding growth factor 1; heparin-binding growth factor 1; beta-endothelial cell growth factor; endothelial cell growth factor, beta; endothelial cell growth factor, alpha; FGF-1; HBGF-1; ECGF-beta; FGF-alpha; |
| Gene ID | 2246 |
| mRNA Refseq | NM_000800 |
| Protein Refseq | NP_000791 |
| MIM | 131220 |
| UniProt ID | P05230 |
| ◆ Recombinant Proteins | ||
| FGF1-8498H | Active Recombinant Human FGF1, His-tagged | +Inquiry |
| FGF1-244H | Recombinant Human FGF1, StrepII-tagged | +Inquiry |
| Fgf1-558M | Recombinant Mouse Fgf1 protein | +Inquiry |
| FGF1-6735C | Recombinant Chicken FGF1 | +Inquiry |
| FGF1-1692R | Recombinant Rhesus monkey FGF1 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| FGF1-26203TH | Native Human FGF1 | +Inquiry |
| FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF1 Products
Required fields are marked with *
My Review for All FGF1 Products
Required fields are marked with *
