Recombinant Human FGF11 Protein, GST-tagged
Cat.No. : | FGF11-4101H |
Product Overview : | Human FGF11 partial ORF ( NP_004103, 15 a.a. - 103 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this gene has not yet been determined. The expression pattern of the mouse homolog implies a role in nervous system development. [provided by RefSeq |
Molecular Mass : | 35.53 kDa |
AA Sequence : | VREPGGSRPVSAQRRVCPRGTKSLCQKQLLILLSKVRLCGGRPARPDRGPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF11 fibroblast growth factor 11 [ Homo sapiens ] |
Official Symbol | FGF11 |
Synonyms | FGF11; fibroblast growth factor 11; FHF3; fibroblast growth factor homologous factor 3; FLJ16061; MGC45269; MGC102953; FHF-3; FGF-11; |
Gene ID | 2256 |
mRNA Refseq | NM_004112 |
Protein Refseq | NP_004103 |
MIM | 601514 |
UniProt ID | Q92914 |
◆ Recombinant Proteins | ||
FGF11-5839M | Recombinant Mouse FGF11 Protein | +Inquiry |
FGF11-104H | Active Recombinant Human FGF11 Protein (Pro64-Pro225), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF11-3226M | Recombinant Mouse FGF11 Protein, His (Fc)-Avi-tagged | +Inquiry |
FGF11-103H | Active Recombinant Human FGF11 Protein (Met1-Pro225), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF11-025H | Recombinant Human FGF11 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF11 Products
Required fields are marked with *
My Review for All FGF11 Products
Required fields are marked with *