Recombinant Human FGF13 protein(212-245 aa), GST-tagged

• Cat.No.: FGF13-12864H
• Product Overview: Recombinant Human FGF13 protein(212-245 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 212-245 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

Gene Information

• Gene Name: FGF13 fibroblast growth factor 13 [ Homo sapiens ]
• Official Symbol: FGF13
• Synonyms: FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2; FHF-2; FGF-13
• Gene ID: 2258
• mRNA Refseq: NM_001139498
• Protein Refseq: NP_001132970
• MIM: 300070
• UniProt ID: Q92913