Recombinant Human FGF13 protein(212-245 aa), GST-tagged
Cat.No. : | FGF13-12864H |
Product Overview : | Recombinant Human FGF13 protein(212-245 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 212-245 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST |
Gene Name | FGF13 fibroblast growth factor 13 [ Homo sapiens ] |
Official Symbol | FGF13 |
Synonyms | FGF13; fibroblast growth factor 13; FGF2; FHF2; fibroblast growth factor homologous factor 2; FHF-2; FGF-13; |
Gene ID | 2258 |
mRNA Refseq | NM_001139498 |
Protein Refseq | NP_001132970 |
MIM | 300070 |
UniProt ID | Q92913 |
◆ Recombinant Proteins | ||
FGF13-2326R | Recombinant Rat FGF13 Protein | +Inquiry |
FGF13-12864H | Recombinant Human FGF13 protein(212-245 aa), GST-tagged | +Inquiry |
Fgf13-8156R | Recombinant Rat Fgf13 protein, His-tagged | +Inquiry |
FGF13-4810HF | Recombinant Full Length Human FGF13 Protein, GST-tagged | +Inquiry |
FGF13-2907H | Recombinant Human FGF13 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF13-6248HCL | Recombinant Human FGF13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF13 Products
Required fields are marked with *
My Review for All FGF13 Products
Required fields are marked with *
0
Inquiry Basket