Recombinant Human FGF14 protein, GST-tagged
Cat.No. : | FGF14-2908H |
Product Overview : | Recombinant Human FGF14 protein(Q92915)(1-252aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-252aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.5 kDa |
AA Sequence : | MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FGF14 fibroblast growth factor 14 [ Homo sapiens ] |
Official Symbol | FGF14 |
Synonyms | FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129; |
Gene ID | 2259 |
mRNA Refseq | NM_004115 |
Protein Refseq | NP_004106 |
MIM | 601515 |
UniProt ID | Q92915 |
◆ Recombinant Proteins | ||
FGF14-2036Z | Recombinant Zebrafish FGF14 | +Inquiry |
FGF14-2327R | Recombinant Rat FGF14 Protein | +Inquiry |
fgf14-169C | Active Recombinant Canine fgf14 | +Inquiry |
FGF14-4104H | Recombinant Human FGF14 Protein, GST-tagged | +Inquiry |
FGF14-6341C | Recombinant Chicken FGF14 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF14-6246HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
FGF14-6247HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF14 Products
Required fields are marked with *
My Review for All FGF14 Products
Required fields are marked with *