Recombinant Human FGF14 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | FGF14-2246H |
| Product Overview : | FGF14 MS Standard C13 and N15-labeled recombinant protein (NP_004106) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. |
| Molecular Mass : | 27.5 kDa |
| AA Sequence : | MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTTTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | FGF14 fibroblast growth factor 14 [ Homo sapiens (human) ] |
| Official Symbol | FGF14 |
| Synonyms | FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129; |
| Gene ID | 2259 |
| mRNA Refseq | NM_004115 |
| Protein Refseq | NP_004106 |
| MIM | 601515 |
| UniProt ID | Q92915 |
| ◆ Recombinant Proteins | ||
| FGF14-566H | Active Recombinant Human FGF14 Protein | +Inquiry |
| FGF14-5842M | Recombinant Mouse FGF14 Protein | +Inquiry |
| Fgf14-2995M | Recombinant Mouse Fgf14 Protein, Myc/DDK-tagged | +Inquiry |
| FGF14-4104H | Recombinant Human FGF14 Protein, GST-tagged | +Inquiry |
| fgf14-169C | Active Recombinant Canine fgf14 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF14-6247HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
| FGF14-6246HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF14 Products
Required fields are marked with *
My Review for All FGF14 Products
Required fields are marked with *
