Recombinant Human FGF14 Protein, GST-tagged
| Cat.No. : | FGF14-4104H |
| Product Overview : | Human FGF14 partial ORF ( NP_004106, 138 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | LFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FGF14 fibroblast growth factor 14 [ Homo sapiens ] |
| Official Symbol | FGF14 |
| Synonyms | FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129; |
| Gene ID | 2259 |
| mRNA Refseq | NM_004115 |
| Protein Refseq | NP_004106 |
| MIM | 601515 |
| UniProt ID | Q92915 |
| ◆ Recombinant Proteins | ||
| FGF14-6341C | Recombinant Chicken FGF14 | +Inquiry |
| FGF14-566H | Active Recombinant Human FGF14 Protein | +Inquiry |
| FGF14-028H | Recombinant Human FGF14 Protein | +Inquiry |
| FGF14-2246H | Recombinant Human FGF14 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FGF14-2908H | Recombinant Human FGF14 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF14-6246HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
| FGF14-6247HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF14 Products
Required fields are marked with *
My Review for All FGF14 Products
Required fields are marked with *




