Recombinant Human FGF14 Protein, GST-tagged
Cat.No. : | FGF14-4104H |
Product Overview : | Human FGF14 partial ORF ( NP_004106, 138 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. A mutation in this gene is associated with autosomal dominant cerebral ataxia. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | LFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FGF14 fibroblast growth factor 14 [ Homo sapiens ] |
Official Symbol | FGF14 |
Synonyms | FGF14; fibroblast growth factor 14; FHF4; SCA27; bA397O8.2; fibroblast growth factor homologous factor 4; FHF-4; FGF-14; MGC119129; |
Gene ID | 2259 |
mRNA Refseq | NM_004115 |
Protein Refseq | NP_004106 |
MIM | 601515 |
UniProt ID | Q92915 |
◆ Recombinant Proteins | ||
fgf14-169C | Active Recombinant Canine fgf14 | +Inquiry |
FGF14-5842M | Recombinant Mouse FGF14 Protein | +Inquiry |
FGF14-107H | Active Recombinant Human FGF14 Protein (Ala2-Thr246), N-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF14-3239H | Recombinant Human FGF14 Protein (Met1-Thr252, isoform2), C-His tagged | +Inquiry |
FGF14-1984R | Recombinant Rat FGF14 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF14-6246HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
FGF14-6247HCL | Recombinant Human FGF14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF14 Products
Required fields are marked with *
My Review for All FGF14 Products
Required fields are marked with *