Recombinant Human FGF19 protein, His-tagged
| Cat.No. : | FGF19-3970H |
| Product Overview : | Recombinant Human FGF19 protein(30-216 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 30-216 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | AGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRYLCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPFGLVTGLEAVRSPSFEK |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | FGF19 fibroblast growth factor 19 [ Homo sapiens ] |
| Official Symbol | FGF19 |
| Synonyms | FGF19; fibroblast growth factor 19; FGF-19; |
| Gene ID | 9965 |
| mRNA Refseq | NM_005117 |
| Protein Refseq | NP_005108 |
| MIM | 603891 |
| UniProt ID | O95750 |
| ◆ Recombinant Proteins | ||
| FGF19-7336H | Recombinant Human FGF19 protein(Phe27-Lys216) | +Inquiry |
| FGF19-121F | Active Recombinant Human FGF19 Protein (195 aa) | +Inquiry |
| FGF19-5231H | Recombinant Human FGF19 protein, GST-tagged | +Inquiry |
| FGF19-857HFL | Recombinant Full Length Human FGF19 Protein, C-Flag-tagged | +Inquiry |
| FGF19-238H | Recombinant Human FGF19 protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGF19-6244HCL | Recombinant Human FGF19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF19 Products
Required fields are marked with *
My Review for All FGF19 Products
Required fields are marked with *
