Recombinant Rat FGF9 Protein

Cat.No. : FGF9-96R
Product Overview : Recombinant Rat FGF9 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Description : Fibroblast growth factor 9 (FGF-9) is a mitogen and survival factor for nerve and mesenchymal cells. FGF-9 functions as an autocrine and paracrine factor to support the growth and survival of motor neurons and prostate tissue. FGF-9 expression in the gonad is also necessary for sex determination.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 23.3 kDa (207 aa)
AA Sequence : MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 75 mM ammonium sulfate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Fgf9 fibroblast growth factor 9 [ Rattus norvegicus (Norway rat) ]
Official Symbol FGF9
Synonyms FGF9; fibroblast growth factor 9; GAF; FGF-9; HBGF-9; glia-activating factor;
Gene ID 25444
mRNA Refseq NM_012952
Protein Refseq NP_037084
UniProt ID P36364

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF9 Products

Required fields are marked with *

My Review for All FGF9 Products

Required fields are marked with *

0
cart-icon
0
compare icon