Recombinant Human FGFR4, Fc-tagged

Cat.No. : FGFR4-27013TH
Product Overview : Recombinant fragment, corresponding to amino acids 22-201 of Human FGFR4 fused to the Fc region of human IgG1 expressed in modified human 293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : Fc
Protein Length : 22-201 a.a.
Description : The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. The genomic organization of this gene, compared to members 1-3, encompasses 18 exons rather than 19 or 20. Although alternative splicing has been observed, there is no evidence that the C-terminal half of the IgIII domain of this protein varies between three alternate forms, as indicated for members 1-3. This particular family member preferentially binds acidic fibroblast growth factor and, although its specific function is unknown, it is overexpressed in gynecological tumor samples, suggesting a role in breast and ovarian tumorigenesis.
Conjugation : Fc
Form : Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco
Purity : >95% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin
Storage : Store at +4°C.
Sequences of amino acids : Theoretical Sequence:LEASEEVELEPCLAPSLEQQEQELTVALG QPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEI ASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDE DPKSHRDLSNRHSYPQQAPYWTHPQRMEKKLHAVPAGN TVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK
Gene Name FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ]
Official Symbol FGFR4
Synonyms FGFR4; fibroblast growth factor receptor 4; CD334; JTK2;
Gene ID 2264
mRNA Refseq NM_002011
Protein Refseq NP_002002
MIM 134935
Uniprot ID P22455
Chromosome Location 5q33-qter
Pathway Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem;
Function ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGFR4 Products

Required fields are marked with *

My Review for All FGFR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon