Recombinant Human FGFR4, Fc-tagged
| Cat.No. : | FGFR4-27013TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 22-201 of Human FGFR4 fused to the Fc region of human IgG1 expressed in modified human 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Fc |
| Protein Length : | 22-201 a.a. |
| Description : | The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein would consist of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. The genomic organization of this gene, compared to members 1-3, encompasses 18 exons rather than 19 or 20. Although alternative splicing has been observed, there is no evidence that the C-terminal half of the IgIII domain of this protein varies between three alternate forms, as indicated for members 1-3. This particular family member preferentially binds acidic fibroblast growth factor and, although its specific function is unknown, it is overexpressed in gynecological tumor samples, suggesting a role in breast and ovarian tumorigenesis. |
| Conjugation : | Fc |
| Form : | Lyophilised:It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial.Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not reco |
| Purity : | >95% by SDS-PAGE |
| Storage buffer : | Preservative: NoneConstituents: 10% Trehalose, 1% Human serum albumin |
| Storage : | Store at +4°C. |
| Sequences of amino acids : | Theoretical Sequence:LEASEEVELEPCLAPSLEQQEQELTVALG QPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEI ASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDE DPKSHRDLSNRHSYPQQAPYWTHPQRMEKKLHAVPAGN TVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRIPK VDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAK TKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLT CLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK |
| Gene Name | FGFR4 fibroblast growth factor receptor 4 [ Homo sapiens ] |
| Official Symbol | FGFR4 |
| Synonyms | FGFR4; fibroblast growth factor receptor 4; CD334; JTK2; |
| Gene ID | 2264 |
| mRNA Refseq | NM_002011 |
| Protein Refseq | NP_002002 |
| MIM | 134935 |
| Uniprot ID | P22455 |
| Chromosome Location | 5q33-qter |
| Pathway | Downstream signaling of activated FGFR, organism-specific biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; FGF signaling pathway, organism-specific biosystem; FGFR ligand binding and activation, organism-specific biosystem; |
| Function | ATP binding; fibroblast growth factor 1 binding; fibroblast growth factor 2 binding; fibroblast growth factor binding; fibroblast growth factor-activated receptor activity; |
| ◆ Recombinant Proteins | ||
| FGFR4-82RF | Recombinant Monkey FGFR4 Protein, His-tagged, FITC conjugated | +Inquiry |
| FGFR4-152H | Recombinant Human FGFR4 Protein, DYKDDDDK-tagged | +Inquiry |
| FGFR4-4410H | Recombinant Human FGFR4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Fgfr4-709MAF488 | Recombinant Mouse Fgfr4 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| FGFR4-90H | Active Recombinant Human FGFR4, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FGFR4-2757MCL | Recombinant Mouse FGFR4 cell lysate | +Inquiry |
| FGFR4-1907HCL | Recombinant Human FGFR4 cell lysate | +Inquiry |
| FGFR4-1516RCL | Recombinant Rat FGFR4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGFR4 Products
Required fields are marked with *
My Review for All FGFR4 Products
Required fields are marked with *
