"FGL1" Related Products

Expand
Expand

Recombinant Human FGL1 Protein, His-tagged

Cat.No. : FGL1-12886H
Product Overview : Recombinant Human FGL1 Protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag.
Source : E. coli
Species : Human
Tag : His
Form : The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
Protein length : 1-312 aa
AA Sequence : MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI
Purity : > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store for up to 12 months at -20 to -80 centigrade as lyophilized powder.
Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name : FGL1 fibrinogen-like 1 [ Homo sapiens ]
Official Symbol : FGL1
Synonyms : FGL1; fibrinogen-like 1; HFREP 1; hepassocin; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455;
Gene ID : 2267
mRNA Refseq : NM_004467
Protein Refseq : NP_004458
MIM : 605776
UniProt ID : Q08830

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.