Recombinant Human FGL1 Protein, His-tagged
Cat.No. : | FGL1-12886H |
Product Overview : | Recombinant Human FGL1 Protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-312 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI |
Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store for up to 12 months at -20 to -80 centigrade as lyophilized powder. Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
Gene Name | FGL1 fibrinogen-like 1 [ Homo sapiens ] |
Official Symbol | FGL1 |
Synonyms | FGL1; fibrinogen-like 1; HFREP 1; hepassocin; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455; |
Gene ID | 2267 |
mRNA Refseq | NM_004467 |
Protein Refseq | NP_004458 |
MIM | 605776 |
UniProt ID | Q08830 |
◆ Recombinant Proteins | ||
FGL1-225H | Recombinant Human FGL1 protein, hFc-tagged | +Inquiry |
FGL1-130HB | Active Recombinant Human FGL1(Leu23-Ile312) Protein, C-Avi-6*His-tagged, Biotinylated | +Inquiry |
FGL1-8243H | Recombinant Human FGL1 protein, His-tagged | +Inquiry |
FGL1-4932HF | Recombinant Full Length Human FGL1 Protein, GST-tagged | +Inquiry |
FGL1-1452H | Active Recombinant Human FGL1 protein, Avi-Fc-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGL1-6229HCL | Recombinant Human FGL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGL1 Products
Required fields are marked with *
My Review for All FGL1 Products
Required fields are marked with *