Expand| Cat.No. : | FGL1-12886H |
| Product Overview : | Recombinant Human FGL1 Protein is produced by E. coli-derived, PET28a expression system. This protein is fused with a His tag. |
| Source : | E. coli |
| Species : | Human |
| Tag : | His |
| Form : | The purified protein was Lyophilized from sterile PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| Protein length : | 1-312 aa |
| AA Sequence : | MAKVFSFILVTTALTMGREISALEDCAQEQMRLRAQVRLLETRVKQQQVKIKQLLQENEVQFLDKGDENTVIDLGSKRQYADCSEIFNDGYKLSGFYKIKPLQSPAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWLGNKNLHFLTTQEDYTLKIDLADFEKNSRYAQYKNFKVGDEKNFYELNIGEYSGTAGDSLAGNFHPEVQWWASHQRMKFSTWDRDHDNYEGNCAEEDQSGWWFNRCHSANLNGVYYSGPYTAKTDNGIVWYTWHGWWYSLKSVVMKIRPNDFIPNVI |
| Purity : | > 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store for up to 12 months at -20 to -80 centigrade as lyophilized powder. Short-term storage: Store at 2-8 centigrade for (1-2 weeks). Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature. |
| Gene Name : | FGL1 fibrinogen-like 1 [ Homo sapiens ] |
| Official Symbol : | FGL1 |
| Synonyms : | FGL1; fibrinogen-like 1; HFREP 1; hepassocin; HFREP1; HP-041; LFIRE1; LFIRE-1; MGC12455; |
| Gene ID : | 2267 |
| mRNA Refseq : | NM_004467 |
| Protein Refseq : | NP_004458 |
| MIM : | 605776 |
| UniProt ID : | Q08830 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All FGL1 Products
Download Datasheet