Recombinant Human FLNA, GST-tagged
Cat.No. : | FLNA-289H |
Product Overview : | Recombinant Human FLNA(1 a.a. - 838 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an actin-binding protein that crosslinks actin filaments and links actin filaments to membrane glycoproteins. The encoded protein is involved in remodeling the cytoskeleton to effect changes in cell shape and migration. This protein interacts with integrins, transmembrane receptor complexes, and second messengers. Defects in this gene are a cause of several syndromes, including periventricular nodular heterotopias (PVNH1, PVNH4), otopalatodigital syndromes (OPD1, OPD2), frontometaphyseal dysplasia (FMD), Melnick-Needles syndrome (MNS), and X-linked congenital idiopathic intestinal pseudoobstruction (CIIPX). Two transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 117.92 kDa |
AA Sequence : | MPSGKVAQPTITDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVTAYGPGLTHGVVNKPA TFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGTCSVSYLPVLPGDYSILVKYNEQHVPGSPFTARVTGDDSMR MSHLKVGSAADIPINISETDLSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSP IPVVISQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPT EPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGK THEAEIVEGENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEF SIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARR LTVSSLQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGVYLIDVKFNGT HIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGNPAEFVVNTSNAGAGALSVTIDGPSKVKMDCQECPEGYR VTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGPRLVSNHSLHETSSVFVDSLTKATCAPQHGAPGPGPADASK VVAKGLGLSKAYVGQKSSFTVDCSKAGNNMLLVGVHGPRTPCEEILVKHVGSRLYSVSYLLKDKGEYTLVVKWGD EHIPGSPYRVVVP |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FLNA filamin A, alpha [ Homo sapiens ] |
Official Symbol | FLNA |
Synonyms | FLNA; filamin A, alpha; FLN; FMD; MNS; OPD; ABPX; CSBS; CVD1; FLN1; NHBP; OPD1; OPD2; XLVD; XMVD; FLN-A; ABP-280; filamin-A; filamin-1; alpha-filamin; non-muscle filamin; actin binding protein 280; endothelial actin-binding protein |
Gene ID | 2316 |
mRNA Refseq | NM_001456 |
Protein Refseq | NP_001447 |
MIM | 300017 |
UniProt ID | P21333 |
Chromosome Location | Xq28 |
Pathway | Androgen receptor signaling pathway; Cell junction organization; Cell-Cell communication |
Function | Fc-gamma receptor I complex binding; Rac GTPase binding; Ral GTPase binding |
◆ Recombinant Proteins | ||
FLNA-185H | Recombinant Human FLNA protein, MYC/DDK-tagged | +Inquiry |
FLNA-6143C | Recombinant Chicken FLNA | +Inquiry |
FLNA-28906TH | Recombinant Human FLNA, His-tagged | +Inquiry |
FLNA-5086H | Recombinant Human FLNA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FLNA-2923H | Recombinant Human FLNA protein, His&Myc-tagged | +Inquiry |
◆ Native Proteins | ||
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
FLNA-170C | Active Native chicken FLNA | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLNA Products
Required fields are marked with *
My Review for All FLNA Products
Required fields are marked with *