Recombinant Human FLT1 Protein
| Cat.No. : | FLT1-4366H |
| Product Overview : | Human FLT1 (NP_002010.1, 31 a.a. - 328 a.a.) partial recombinant protein expressed in Escherichia coli. |
| Availability | January 06, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 31-328 a.a. |
| Description : | This gene encodes a member of the vascular endothelial growth factor receptor (VEGFR) family. VEGFR family members are receptor tyrosine kinases (RTKs) which contain an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and a tyrosine kinase (TK) domain within the cytoplasmic domain. This protein binds to VEGFR-A, VEGFR-B and placental growth factor and plays an important role in angiogenesis and vasculogenesis. Expression of this receptor is found in vascular endothelial cells, placental trophoblast cells and peripheral blood monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Isoforms include a full-length transmembrane receptor isoform and shortened, soluble isoforms. The soluble isoforms are associated with the onset of pre-eclampsia |
| Form : | Liquid |
| AA Sequence : | SLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI |
| Purity : | > 95% by SDS-PAGE |
| Applications : | Western Blot Immunohistochemistry ELISA Dot Blot SDS-PAGE |
| Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | In Tris (50% glycerol) |
| Gene Name | FLT1 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) [ Homo sapiens ] |
| Official Symbol | FLT1 |
| Synonyms | FLT1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FLT; vascular endothelial growth factor receptor 1; VEGFR1; FLT-1; VEGFR-1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor; |
| Gene ID | 2321 |
| mRNA Refseq | NM_001159920 |
| Protein Refseq | NP_001153392 |
| MIM | 165070 |
| UniProt ID | P17948 |
| ◆ Recombinant Proteins | ||
| Flt1-8712RAF488 | Recombinant Rat Flt1 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| FLT1-241H | Active Recombinant Human FLT1, Fc Chimera | +Inquiry |
| Flt1-8114M | Recombinant Mouse Flt1 protein, mFc-tagged | +Inquiry |
| Flt1-49M | Recombinant Mouse Flt1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| FLT1-615H | Active Recombinant Human FLT1, Fc-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT1-1909HCL | Recombinant Human FLT1 cell lysate | +Inquiry |
| FLT1-1207RCL | Recombinant Rat FLT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT1 Products
Required fields are marked with *
My Review for All FLT1 Products
Required fields are marked with *
