Recombinant Active Mouse FLT3LG Protein, His-tagged(C-ter)

Cat.No. : Flt3l-96M
Product Overview : Recombinant Active Mouse FLT3LG Protein with His tag (C-ter) was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Description : Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).[supplied by OMIM, Jan 2011]
Form : Powder
Bio-activity : Determined by its ability to induce proliferation in BaF3 mouse pro-B cells transfected with mouse Flt-3. The ED50
AA Sequence : MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR
Endotoxin : Endotoxin level is less than 0.1 EU/μg of the protein, as determined by the LAL test.
Purity : > 98% (by SDS-PAGE)
Applications : SDS-PAGE
Notes : For laboratory research only, not for drug, diagnostic or other use.
Storage : Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
Storage Buffer : PBS (pH 7.4)
Reconstitution : It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely.
Gene Name Flt3l FMS-like tyrosine kinase 3 ligand [ Mus musculus (house mouse) ]
Official Symbol Flt3l
Synonyms Flt3l; FMS-like tyrosine kinase 3 ligand; Ly72L; Flt3lg; fms-related tyrosine kinase 3 ligand; flt3 ligand
Gene ID 14256
mRNA Refseq NM_013520
Protein Refseq NP_038548
UniProt ID A9QW46

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3LG Products

Required fields are marked with *

My Review for All FLT3LG Products

Required fields are marked with *

0
cart-icon
0
compare icon