Recombinant Human FLT3LG protein, His-SUMO-tagged
Cat.No. : | FLT3LG-2924H |
Product Overview : | Recombinant Human FLT3LG protein(P49771)(27-184aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-184aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 33.9 kDa |
AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-1235H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-4374H | Active Recombinant Human FLT3LG Protein, His-tagged | +Inquiry |
FLT3LG-110H | Active Recombinant Human FLT3LG Protein (Thr27-Ala181), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FLT3LG-25H | Active Recombinant Human FLT3L protein | +Inquiry |
FLT3LG-489H | Recombinant Human FLT3LG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket