Recombinant Human FLT3LG protein, His-SUMO-tagged
| Cat.No. : | FLT3LG-2924H |
| Product Overview : | Recombinant Human FLT3LG protein(P49771)(27-184aa), fused to N-terminal His tag and SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 27-184aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 33.9 kDa |
| AA Sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
| Official Symbol | FLT3LG |
| Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
| Gene ID | 2323 |
| mRNA Refseq | NM_001204502 |
| Protein Refseq | NP_001191431 |
| MIM | 600007 |
| UniProt ID | P49771 |
| ◆ Recombinant Proteins | ||
| FLT3LG-16H | Active Recombinant Human FLT3LG Protein, Animal Free | +Inquiry |
| FLT3LG-4138H | Recombinant Human FLT3LG Protein (Ser25-Pro184), C-His tagged | +Inquiry |
| FLT3LG-28341TH | Recombinant Human FLT3LG, His-tagged | +Inquiry |
| FLT3LG-278H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, HIgG1 Fc-tagged | +Inquiry |
| FLT3LG-275H | Active Recombinant Human Fms-related Tyrosine Kinase 3 Ligand, MIgG2a Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *




