Recombinant Human FLT3LG Protein, His-tagged

• Cat.No.: FLT3LG-939H
• Product Overview: Recombinant Human FLT3LG, transcript variant 3, fused with His tag at C-terminal was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Description: Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]).
• Form: Lyophilized from a 0.2 µM filtered solution of20mM TrisHCl, pH8.0
• Molecular Mass: 18.9kD
• AA Sequence: MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Gene Information

• Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L
• Gene ID: 2323
• mRNA Refseq: NM_001204502
• Protein Refseq: NP_001191431
• MIM: 600007
• UniProt ID: P49771