Recombinant Human FLT3LG Protein, His-tagged
Cat.No. : | FLT3LG-939H |
Product Overview : | Recombinant Human FLT3LG, transcript variant 3, fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Dendritic cells (DCs) provide the key link between innate and adaptive immunity by recognizing pathogens and priming pathogen-specific immune responses. FLT3LG controls the development of DCs and is particularly important for plasmacytoid DCs and CD8 (see MIM 186910)-positive classical DCs and their CD103 (ITGAE; MIM 604682)-positive tissue counterparts (summary by Sathaliyawala et al., 2010 [PubMed 20933441]). |
Form : | Lyophilized from a 0.2 µM filtered solution of20mM TrisHCl, pH8.0 |
Molecular Mass : | 18.9kD |
AA Sequence : | MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ] |
Official Symbol | FLT3LG |
Synonyms | FLT3LG; fms-related tyrosine kinase 3 ligand; flt3 ligand; FL; FLT3L; |
Gene ID | 2323 |
mRNA Refseq | NM_001204502 |
Protein Refseq | NP_001191431 |
MIM | 600007 |
UniProt ID | P49771 |
◆ Recombinant Proteins | ||
FLT3LG-110H | Active Recombinant Human FLT3LG Protein (Thr27-Ala181), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Flt3lg-1357M | Recombinant Mouse Flt3lg protein, His-tagged | +Inquiry |
Flt3lg-2189R | Recombinant Rat Flt3lg Protein, His-tagged | +Inquiry |
FLT3LG-152H | Active Recombinant Human FLT3LG | +Inquiry |
FLT3LG-28341TH | Recombinant Human FLT3LG, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3LG-001HCL | Recombinant Human FLT3LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FLT3LG Products
Required fields are marked with *
My Review for All FLT3LG Products
Required fields are marked with *
0
Inquiry Basket