Recombinant Human FOSL1 Protein, GST-tagged
| Cat.No. : | FOSL1-4427H |
| Product Overview : | Human FOSL1 full-length ORF ( AAH16648.1, 1 a.a. - 271 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. [provided by RefSeq |
| Molecular Mass : | 55.44 kDa |
| AA Sequence : | MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FOSL1 FOS-like antigen 1 [ Homo sapiens ] |
| Official Symbol | FOSL1 |
| Synonyms | FOSL1; FOS-like antigen 1; fos-related antigen 1; fra 1; FOS-like antigen-1; FRA; FRA1; fra-1; |
| Gene ID | 8061 |
| mRNA Refseq | NM_005438 |
| Protein Refseq | NP_005429 |
| MIM | 136515 |
| UniProt ID | P15407 |
| ◆ Recombinant Proteins | ||
| FOSL1-8500H | Active Recombinant Human FOSL1, His-tagged | +Inquiry |
| FOSL1-5606H | Recombinant Human FOSL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| FOSL1-1034H | Active Recombinant Human FOS-like Antigen 1 | +Inquiry |
| Fosl1-1623R | Recombinant Rat Fosl1 protein, His & GST-tagged | +Inquiry |
| Fosl1-7853M | Recombinant Mouse Fosl1 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOSL1-6166HCL | Recombinant Human FOSL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOSL1 Products
Required fields are marked with *
My Review for All FOSL1 Products
Required fields are marked with *


