Recombinant Human FOXC2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: FOXC2-3485H
• Product Overview: FOXC2 MS Standard C13 and N15-labeled recombinant protein (NP_005242) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
• Molecular Mass: 53.5 kDa
• AA Sequence: MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRTSPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCVPPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: FOXC2 forkhead box C2 [ Homo sapiens (human) ]
• Official Symbol: FOXC2
• Synonyms: FOXC2; forkhead box C2 (MFH-1, mesenchyme forkhead 1); FKHL14; forkhead box protein C2; MFH 1; MFH-1,mesenchyme forkhead 1; transcription factor FKH-14; mesenchyme fork head protein 1; forkhead-related protein FKHL14; forkhead, Drosophila, homolog-like 14; LD; MFH1; MFH-1
• Gene ID: 2303
• mRNA Refseq: NM_005251
• Protein Refseq: NP_005242
• MIM: 602402
• UniProt ID: Q99958