Recombinant Human FOXO1 Protein, GST-tagged
Cat.No. : | FOXO1-4469H |
Product Overview : | Human FOXO1 partial ORF (NP_002006.2, 452 a.a. - 555 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 452-555 a.a. |
Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq |
Molecular Mass : | 37.07 kDa |
AA Sequence : | MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FOXO1 forkhead box O1 [ Homo sapiens ] |
Official Symbol | FOXO1 |
Synonyms | FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma, FOXO1A; forkhead box protein O1; FKH1; forkhead box protein O1A; forkhead, Drosophila, homolog of, in rhabdomyosarcoma; FKHR; FOXO1A; |
Gene ID | 2308 |
mRNA Refseq | NM_002015 |
Protein Refseq | NP_002006 |
MIM | 136533 |
UniProt ID | Q12778 |
◆ Recombinant Proteins | ||
FOXO1-146H | Recombinant Human FOXO1 protein, MYC/DDK-tagged | +Inquiry |
FOXO1-5901C | Recombinant Chicken FOXO1 | +Inquiry |
FOXO1-4469H | Recombinant Human FOXO1 Protein, GST-tagged | +Inquiry |
FOXO1-935H | Recombinant Human FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FOXO1-3334M | Recombinant Mouse FOXO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXO1 Products
Required fields are marked with *
My Review for All FOXO1 Products
Required fields are marked with *