Recombinant Human FOXO1 Protein, GST-tagged
| Cat.No. : | FOXO1-4469H |
| Product Overview : | Human FOXO1 partial ORF (NP_002006.2, 452 a.a. - 555 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 452-555 a.a. |
| Description : | This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq |
| Molecular Mass : | 37.07 kDa |
| AA Sequence : | MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | FOXO1 forkhead box O1 [ Homo sapiens ] |
| Official Symbol | FOXO1 |
| Synonyms | FOXO1; forkhead box O1; FKHR, forkhead homolog in rhabdomyosarcoma, FOXO1A; forkhead box protein O1; FKH1; forkhead box protein O1A; forkhead, Drosophila, homolog of, in rhabdomyosarcoma; FKHR; FOXO1A; |
| Gene ID | 2308 |
| mRNA Refseq | NM_002015 |
| Protein Refseq | NP_002006 |
| MIM | 136533 |
| UniProt ID | Q12778 |
| ◆ Recombinant Proteins | ||
| FOXO1-4469H | Recombinant Human FOXO1 Protein, GST-tagged | +Inquiry |
| FOXO1-1038HFL | Active Recombinant Full Length Human FOXO1 Protein, C-Flag-tagged | +Inquiry |
| Foxo1-3077M | Recombinant Mouse Foxo1 Protein, Myc/DDK-tagged | +Inquiry |
| FOXO1-146H | Recombinant Human FOXO1 protein, MYC/DDK-tagged | +Inquiry |
| FOXO1-28946TH | Recombinant Human FOXO1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| FOXO1-6149HCL | Recombinant Human FOXO1 293 Cell Lysate | +Inquiry |
| FOXO1-502HKCL | Human FOXO1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXO1 Products
Required fields are marked with *
My Review for All FOXO1 Products
Required fields are marked with *



