Recombinant Human FOXP1 protein, His-tagged
Cat.No. : | FOXP1-2447H |
Product Overview : | Recombinant Human FOXP1 protein(349-457 aa), fused to His tag, was expressed in E. coli. |
Availability | September 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 349-457 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | QLELQLAKDKERLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQGPSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | FOXP1 forkhead box P1 [ Homo sapiens ] |
Official Symbol | FOXP1 |
Synonyms | FOXP1; forkhead box P1; forkhead box protein P1; 12CC4; fork head related protein like B; glutamine rich factor 1; hFKH1B; HSPC215; PAX5/FOXP1 fusion protein; QRF1; glutamine-rich factor 1; fork head-related protein like B; FLJ23741; MGC12942; MGC88572; MGC99551; |
Gene ID | 27086 |
mRNA Refseq | NM_001012505 |
Protein Refseq | NP_001012523 |
MIM | 605515 |
UniProt ID | Q9H334 |
◆ Recombinant Proteins | ||
FOXP1-12H | Recombinant Human FOXP1 protein, GST-tagged | +Inquiry |
FOXP1-5163H | Recombinant Human FOXP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FOXP1-28111TH | Recombinant Human FOXP1, His-tagged | +Inquiry |
FOXP1-2447H | Recombinant Human FOXP1 protein, His-tagged | +Inquiry |
FOXP1-2388R | Recombinant Rat FOXP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOXP1-6146HCL | Recombinant Human FOXP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FOXP1 Products
Required fields are marked with *
My Review for All FOXP1 Products
Required fields are marked with *