Recombinant Human FPR1 protein, GST-tagged
Cat.No. : | FPR1-274H |
Product Overview : | Recombinant Human FPR1(1 a.a. - 350 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1-350 a.a. |
Description : | This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 64.8 kDa |
AA Sequence : | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
Official Symbol | FPR1 |
Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor; |
Gene ID | 2357 |
mRNA Refseq | NM_002029 |
Protein Refseq | NP_002020 |
MIM | 136537 |
UniProt ID | P21462 |
Chromosome Location | 19q13.41 |
Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
Function | G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
FPR1-1524H | Recombinant Human FPR1 Protein, His&GST-tagged | +Inquiry |
FPR1-263H | Recombinant Human FPR1 protein | +Inquiry |
FPR1-676HF | Recombinant Full Length Human FPR1 Protein | +Inquiry |
FPR1-2994H | Recombinant Human FPR1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *
0
Inquiry Basket