Recombinant Human FPR1 protein, GST-tagged
| Cat.No. : | FPR1-274H |
| Product Overview : | Recombinant Human FPR1(1 a.a. - 350 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-350 a.a. |
| Description : | This gene encodes a G protein-coupled receptor of mammalian phagocytic cells that is a member of the G-protein coupled receptor 1 family. The protein mediates the response of phagocytic cells to invasion of the host by microorganisms and is important in host defense and inflammation. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 64.8 kDa |
| AA Sequence : | METNSSLPTNISGGTPAVSAGYLFLDIITYLVFAVTFVLGVLGNGLVIWVAGFRMTHTVTTISYLNLAVADFCFT STLPFFMVRKAMGGHWPFGWFLCKFVFTIVDINLFGSVFLIALIALDRCVCVLHPVWTQNHRTVSLAKKVIIGPW VMALLLTLPVIIRVTTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLTVRGIIRFIIGFSAPMSIVAVSYGLIA TKIHKQGLIKSSRPLRVLSFVAAAFFLCWSPYQVVALIATVRIRELLQGMYKEIGIAVDVTSALAFFNSCLNPML YVFMGQDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | FPR1 formyl peptide receptor 1 [ Homo sapiens ] |
| Official Symbol | FPR1 |
| Synonyms | FPR1; formyl peptide receptor 1; fMet-Leu-Phe receptor; FMLP; FPR; fMLP receptor; N-formylpeptide chemoattractant receptor; |
| Gene ID | 2357 |
| mRNA Refseq | NM_002029 |
| Protein Refseq | NP_002020 |
| MIM | 136537 |
| UniProt ID | P21462 |
| Chromosome Location | 19q13.41 |
| Pathway | Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; Formyl peptide receptors bind formyl peptides and many other ligands, organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; |
| Function | G-protein coupled receptor activity; N-formyl peptide receptor activity; receptor activity; signal transducer activity; |
| ◆ Recombinant Proteins | ||
| FPR1-2489H | Recombinant Human FPR1 Protein (306-350 aa), His-GST-Myc-tagged | +Inquiry |
| FPR1-263H | Recombinant Human FPR1 protein | +Inquiry |
| RFL15648GF | Recombinant Full Length Gorilla Gorilla Gorilla Fmet-Leu-Phe Receptor(Fpr1) Protein, His-Tagged | +Inquiry |
| FPR1-2882H | Recombinant Human FPR1 Protein (Arg163-Val242), N-GST tagged | +Inquiry |
| FPR1-6022M | Recombinant Mouse FPR1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FPR1 Products
Required fields are marked with *
My Review for All FPR1 Products
Required fields are marked with *



