Recombinant Human FTCD protein(1-541aa), His-tagged
Cat.No. : | FTCD-532H |
Product Overview : | Recombinant Human FTCD protein(O95954)(1-541aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-541aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 65.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSQLVECVPNFSEGKNQEVIDAISGAITQTPGCVLLDVDAGPSTNRTVYTFVGPPECVVEGALNAARVASRLIDMSRHQGEHPRMGALDVCPFIPVRGVSVDECVLCAQAFGQRLAEELDVPVYLYGEAARMDSRRTLPAIRAGEYEALPKKLQQADWAPDFGPSSFVPSWGATATGARKFLIAFNINLLGTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLDEKNLAQVSTNLLDFEVTALHTVYEETCREAQELSLPVVGSQLVGLVPLKALLDAAAFYCEKENLFILEEEQRIRLVVSRLGLDSLCPFSPKERIIEYLVPERGPERGLGSKSLRAFVGEVGARSAAPGGGSVAAAAAAMGAALGSMVGLMTYGRRQFQSLDTTMRRLIPPFREASAKLTTLVDADAEAFTAYLEAMRLPKNTPEEKDRRTAALQEGLRRAVSVPLTLAETVASLWPALQELARCGNLACRSDLQVAAKALEMGVFGAYFNVLINLRDITDEAFKDQIHHRVSSLLQEAKTQAALVLDCLETRQE |
Gene Name | FTCD formiminotransferase cyclodeaminase [ Homo sapiens ] |
Official Symbol | FTCD |
Synonyms | FTCD; formiminotransferase cyclodeaminase; formimidoyltransferase-cyclodeaminase; formiminotransferase-cyclodeaminase; formimidoyltransferase cyclodeaminase; LCHC1; |
Gene ID | 10841 |
mRNA Refseq | NM_006657 |
Protein Refseq | NP_006648 |
MIM | 606806 |
UniProt ID | O95954 |
◆ Recombinant Proteins | ||
FTCD-37H | Recombinant Human FTCD, His-tagged | +Inquiry |
FTCD-5746H | Recombinant Human FTCD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
FTCD-3379M | Recombinant Mouse FTCD Protein, His (Fc)-Avi-tagged | +Inquiry |
FTCD-3300H | Recombinant Human FTCD protein(Met1-Glu541), His-tagged | +Inquiry |
FTCD-432P | Recombinant Pig FTCD protein(1-326aa), MBP&His-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FTCD-6129HCL | Recombinant Human FTCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FTCD Products
Required fields are marked with *
My Review for All FTCD Products
Required fields are marked with *
0
Inquiry Basket